Explore web search results related to this domain and discover relevant information.
Green Card holders in the US could face deportation under a new immigration bill passed by the House of Representatives.
If found guilty of driving under the influence, many foreigners, even those with US green cards, face deportation.The US House of Representatives passed a bill that would allow for the immediate deportation of illegal immigrants convicted of driving under the influence (DUI). Foreigners, including Green card holders, convicted of a DUI, even if classified as a misdemeanor, could face detention and removal.Many foreigners, including several Green card holders in the US, are at risk of deportation if convicted of driving under the influence (DUI) offence.Green card holders are lawful permanent residents of the US and have legal rights to stay and work in America.
Sept. 25 Webinar with Green Century: From Banking to Investing for Climate · AI's Dirty Secret: Big Tech Breaks Clean Energy Promises · Google, Meta, Amazon, and Microsoft pledged to use 100% renewable energy but are powering AI with fossil fuels and nuclear.
Let us inspire you! Take action against corporate greed, learn new ways to reduce your impact on the planet, and discover green products you never knew existed.Green America's mission is to harness economic power—the strength of consumers, investors, businesses, and the marketplace—to create a socially just and environmentally sustainable society. Green America is a national, 501(c)(3) not-for-profit, membership organization founded in 1982.The main landing page of GreenAmerica.org - we harness economic power to create a socially just and environmentally sustainable society.Green America is at greenamerica.org
Access USCIS online services. ... Having a Green Card (officially known as a Permanent Resident Card allows you to live and work permanently in the United States.
Learn more about how and when to replace your Green Card. For policy guidance on adjustment of status, see Volume 7: Adjustment of Status of the USCIS Policy Manual.Official websites use .gov A .gov website belongs to an official government organization in the United States.Secure .gov websites use HTTPS A lock ( ) or https:// means you've safely connected to the .gov website.The steps you must take to apply for a Green Card will vary depending on your individual situation.
News News: The US has halted EB-1 green card issuances until October 1, 2025, after reaching the annual cap for fiscal year 2025. This follows a similar freeze i
The US has halted EB-1 green card issuances until October 1, 2025, after reaching the annual cap for fiscal year 2025. This follows a similar freeze in the EB-2 category. Indian applicants face continued delays, with the EB-1 final action date stuck at February 15, 2022.In a significant development affecting high-skilled immigrant workers, the US Department of State, in coordination with US Citizenship and Immigration Services (USCIS), has announced that the Employment-Based First Preference (EB-1) green card category has reached its annual cap for fiscal year 2025.As a result, US embassies and consulates will not process or issue any new EB-1 immigrant visas until the visa numbers reset on October 1, 2025.Impact on Indian applicantsIndian nationals are among the most affected by this announcement due to long-standing green card backlogs.Despite this potential spillover, demand has exceeded supply, contributing to the cap being reached before the end of the fiscal year.As the outlet reported, the EB-1 category remains a highly sought-after route for top-tier professionals seeking permanent residency in the US. The freeze is therefore expected to delay the path to residency for many skilled professionals.Ongoing delays in EB-2 categoryThe freeze on the EB-1 category follows an earlier announcement halting the EB-2 green card category, which caters to individuals with advanced degrees or exceptional ability.
The power needs of electric vehicles will compel "investment in new wind, solar, storage, and natural gas capacity," new research finds.
Access USCIS online services. ... To apply for a Green Card, you must be eligible under one of the categories listed below.
To apply for a Green Card, you must be eligible under one of the categories listed below. Once you find the category that may fit your situation, click on the link provided to get information on elOfficial websites use .gov A .gov website belongs to an official government organization in the United States.Secure .gov websites use HTTPS A lock ( ) or https:// means you've safely connected to the .gov website.You may be eligible to register for a Green Card if you have resided continuously in the U.S. since before Jan.
Thyssenkrupp Nucera is in intensive discussions with stakeholders in its U.S. projects and is abandoning those no longer deemed feasible due to tax and spending changes initiated by U.S. President Donald Trump, its CEO said on Wednesday.
Global demand for green hydrogen had stalled amid concern among clean-tech players over what Trump's policies would mean for the industry.Trump's sweeping spending and tax legislation has made it harder to develop green tech projects in the U.S.
A new 35-MW green hydrogen electrolyzer from the Accelera branch of Cummins will run on hydropower at a Linde facility in New York.
The green hydrogen industry has the potential to monetize excess capacity from wind farms and solar arrays, gathering up clean kilowatts that would otherwise go to waste. That puts the industry somewhat at odds with the current state of affairs in US energy policy.In one representative analysis, the news organization Hydrogen Insight notes that the bill “remains far less supportive than the Inflation Reduction Act (IRA) ever was and is therefore unlikely to drive a similar scale of investments in US clean hydrogen production — while its impact on upstream sources of renewable energy could make it more difficult for projects to get off the ground.” · In other words, green hydrogen stakeholders are hobbled by the availability (or lack thereof) of renewable energy resources.Its business model is based on turnkey, transportable electrolyzer systems for onsite use, which shaves down costly hydrogen transportation and storage expenses. As with Cummins and Linde, Tobe identifies non-transportation markets for its green hydrogen in the near term, including steelmaking and fertilizer production.If those FIDs don’t materialize here in the US, no worries, Electric Hydrogen is prepared to leverage RED-III, the EU’s latest Renewable Energy Directive framework, for opportunities overseas. Despite some fits and starts, the nations of Europe continue to advocate for the growth of a robust domestic green hydrogen industry to help cut down on imports of Russian gas.
A new U.S. immigration rule allows scrutiny of “anti-American” views when applying for green cards or benefits. U.S. Citizenship and Immigration director Joseph Edlow is defending a new rule targeting
CAMP SPRINGS, Maryland (AP) — A new rule allowing a U.S. immigration agency to scrutinize a person's “anti-American” views when applying for a green card or other benefits isn't designed to target political beliefs, but to identify support for terrorist activity, the organization's director told The Associated Press.We're always interested in hearing about news in our community. Let us know what's going on!
GreenUS Taking care of your well-being in respect of nature GreenUS is the new haircare mini-line for those who love to take care of themselves, their well-being and nature. The natural formulation allows anyone to take care of their hair, treating it gently and respecting its balance.
USD · AEDAMDAZNBDTBNDBWPCADCNYCVEDJFDZDEGPETBEURGMDGNFHKDIDRILSINRJPYKESKGSKHRKMFKRWKZTLAKLKRMADMNTMOPMURMVRMWKMYRNGNNPRPHPPKRQARRWFSARSGDSLLSTDTHBTWDTZSUGXUSDUZSVNDXAFXOF · 0 · 0 / $0.00 · Expressions · Seven Shades · Saturation · Oligoelements · Milk · Silver Shampoo · Purity · Keratin · Intense Restoring · Hyaluronic Acid · GreenUs ·To do this, greenUS has created new natural and professional products in a line designed for taking care of your scalp and roots, Curative, and one thought for taking care of your lengths, Essential. Filter · Best sellingSort · Sort by: FeaturedBest sellingAlphabetically, A-ZAlphabetically, Z-APrice, low to highPrice, high to lowDate, old to newDate, new to old · 250 ML500 ML · Genus · $20.00 USD – $40.00 USD ·Curative Shampoo - GENUS GreenUS The delicate, natural shampoo for scalp care and to strengthen your hair – 99,05% naturalCleansing, protecting and moisturizing the skin: these are the three fundamental steps...Essential Mask - GENUS GreenUS he mask that intensely takes care of your hair thanks to the power of nature – 96,70% natural A concentrate of natural emollients to deeply hydrate...
Forecasts pinned to president’s axing of tax credits and surging electricity demand due to artificial intelligence
US · Companies · Tech · Markets · Climate · Opinion · Lex · Work & Careers · Life & Arts · HTSIFinancial Times · SubscribeSign In · What is the latest news on the UK economy? Western support for Ukraine · How will AI be regulated? UK inflation vs the world ·
The Green Party of the United States (GPUS) is a federation of Green state political parties in the United States. The party promotes green politics, specifically environmentalism, nonviolence, social justice, participatory democracy, anti-war, and anti-racism.
A struggle for the direction of the organization culminated in a "compromise agreement", ratified in 1990 at the Greens National Congress in Elkins, West Virginia and in which both strategies would be accommodated within the same 527 political organization renamed the Greens/Green Party USA (G/GPUSA).The compromise agreement subsequently collapsed and two Green Party organizations co-existed in the United States until 2019 when the Greens/Green Party USA was dissolved. The Green Politics Network was organized in 1990 and the National Association of Statewide Green Parties formed by 1994.They have also called for contraception and abortion procedures to be available on demand. The Green Party has called for the repeal of the Hyde Amendment, an act that prohibits the use of federal taxpayer funds for abortions, unless in the cases of rape, incest, or to save the life of the mother.In 2006, the Green Party developed a Green New Deal that would ultimately serve as a transitional plan to a 100% clean, renewable energy including solar and wind energy by 2030 utilizing a carbon tax, jobs guarantee, tuition-free college, single-payer healthcare and a focus on using public programs.The Green Party of the United States (GPUS) is a federation of Green state political parties in the United States. The party promotes green politics, specifically environmentalism, nonviolence, social justice, participatory democracy, anti-war, and anti-racism.
.svg)
The Trump administration has been slashing green energy incentives, freezing the construction of wind farms and ordering coal-burning power plants to keep running longer than planned. And yet, more American homes and businesses are getting their power from renewable sources than ever before — and in greater amounts. In June, almost one-quarter of US ...
The Trump administration has been slashing green energy incentives, freezing the construction of wind farms and ordering coal-burning power plants to keep running longer than planned. And yet, more American homes and businesses are getting their power from renewable sources than ever before — and in greater amounts. In June, almost one-quarter of US power generation was green, up from 18% in the year-earlier period, according to data compiled from the US Energy Information Administration.New highs for solar and wind power and battery storage are emerging on an almost weekly basis across the country.ExploreNewslettersExplainersPointed News QuizThe Big TakeGraphicsSubmit a TipAbout Us
Gloria Garcia's family says she has been barred from reentering the U.S. for six months.
Gloria Garcia, a 42-year-old woman born in Mexico who has lived in the U.S. for two decades, has been blocked from returning to the U.S. for six months following a required green card interview at the U.S. consulate in Ciudad Juárez, her family and attorney told NBC News. Newsweek has reached out to U.S. Citizenship and Immigration Services (USCIS), the U.S.She says she had to flee a violent relationship with her ex-husband, however there was an administrative error in her divorce that wasn't resolved until she started the process of obtaining a green card in 2019 with an I-130 petition, according to NBC News. She was then granted a temporary waiver application after and had an appointment at the consulate in Mexico, which is typical in the process. At the interview, the official asked to review the divorce paperwork, which was reportedly already approved by USCIS, according to NBC News.The Trump administration has announced that certain speech might cause green card applicants to face scrutiny, particularly students who have posted pro-Hamas beliefs or who have engaged in protests on college campuses where Jewish students are blocked from entering buildings.Many in the process of applying for green cards have reported facing lengthy wait times and some people have been apprehended at various interviews.
Given the hostility of the U.S. government to anything green and the daily drumbeat of headlines about canceled wind farms, tax breaks and environmental rules, you might mistakenly think clean energy is on its deathbed. In fact, by at least one measure, it’s healthier than ever.
Given the hostility of the U.S. government to anything green and the daily drumbeat of headlines about canceled wind farms, tax breaks and environmental rules, you might mistakenly think clean ener…But the real story here might be the European Union, where investment jumped 63% from the second half of 2024 to nearly $76 billion, double the paltry $37 billion in the U.S. In fact, the EU and the U.S. swapped places as the world’s second-biggest destination for green capital after China.Opinion Columnists | Mark Gongloff: The green revolution is alive…
Advanced Hair Technology for Outstanding Results
Green Us · $38.95 · $19.95 – · $39.95Price range: $19.95 through $39.95 · $24.95 · $19.95 – · $39.95Price range: $19.95 through $39.95 · $19.95 – · $39.95Price range: $19.95 through $39.95 · 0 · $0.00 ·
U.S. Green Berets with 10th Special Forces Group (Airborne) kneel in position while preparing for their next movement during a joint training exercise at Fort Carson, Colorado, on Aug. 13. (Sgt. Rhianna Ballenger/U.S. Army) FM 3-05 will “better demonstrate USASOC’s alignment with the Army,” ...
U.S. Green Berets with 10th Special Forces Group (Airborne) kneel in position while preparing for their next movement during a joint training exercise at Fort Carson, Colorado, on Aug. 13. (Sgt. Rhianna Ballenger/U.S. Army) FM 3-05 will “better demonstrate USASOC’s alignment with the Army,” U.S.A new U.S. Army manual has a mission: to convince the regular Army that the Green Berets have value for conventional combat operations.A U.S. Green Beret assigned to 10th Special Forces Group (Airborne) participates in training near Aviona, Greece, on Mar. 12, 2024. (Staff Sgt. Nathan Baker/U.S.A new U.S. Army special operations forces manual has a mission: to convince the regular Army that the Green Berets have value for conventional combat operations.
Agency warns of multiple concerns related to unapproved compounded drugs, including semaglutide and tirzepatide.
Shortages have led to compounding of products using the active pharmaceutical ingredients (APIs) from around the world, including China, India, and Europe. The “green list” includes GLP-1 APIs from facilities that FDA has inspected or valuated that appear to be in compliance with safety standards applicable to US-manufactured APIs.The US FDA has established a “green list” of imported GLP-1 drug ingredients deemed safe and allowed into the country, while keeping out those from unverified foreign sources.Cite this: FDA Establishes ‘Green List’ to Protect US GLP-1 Supply - Medscape - September 08, 2025.Fraudulent compounded semaglutide and tirzepatide have been marketed in the US, containing false information on the product label. In some cases, the compounding pharmacy identified on the label didn’t exist.
Donna Hughes-Brown, who has lived in US since 1977 and wrote cheque a decade ago, being held in isolation by Ice
An Irish grandmother who has lived in the US for most of her life and holds a green card is facing deportation because she wrote a bad cheque for $25 in 2015.Hughes-Brown was born in England and grew up in Ireland before moving as an 11-year-old to the US, where she renewed her green card but never became a citizen.The case has parallels with other cases, including that of Cliona Ward, a green card holder who was detained in April at San Francisco airport after a visit to Ireland because of offences dating back almost 20 years.Her husband, Jim Brown, a US citizen and military veteran, told reporters his wife was not a criminal and that he “100%” regretted voting for Donald Trump as president.
USGBC is committed to a sustainable, prosperous future through LEED. Our mission is to transform the way buildings and communities are designed, built and operated, enabling an environmentally and socially responsible environment.
Green building has the power to impact businesses, the economy, our communities and the way we live. Explore how green building work is driving better decisions in design, construction and operations across our buildings, cities and communities. ... USGBC members are leading the future of green building and driving impactful change.USGBC leaders will address critical topics for the industry such as green finance and decarbonization.Gracie TilmanUSGBC is committed to a sustainable, prosperous future through LEED. Our mission is to transform the way buildings and communities are designed, built and operated, enabling an environmentally and socially responsible environment.Explore products, materials and technologies at Greenbuild that can help you meet sustainability goals.Heather Benjamin